PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21706
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 1032aa    MW: 113809 Da    PI: 4.8518
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21706genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.94e-53221501129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
               l+pGfrFhPtdeelv++yLk+kv g++l++ ++i+evd+ykvePwdLp+  ++++++++wyfFs+ d+k+a+  r+nrat+ gyWk+tgkd+ev + + ++
  EMT21706  22 LAPGFRFHPTDEELVSYYLKRKVLGRPLKV-DAIAEVDLYKVEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRATAGGYWKTTGKDREVRH-GARV 120
               579***************************.99***************4357888999**************************************.999* PP

       NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
               vg+kktLvf+ grapkge+t+Wvmheyrle
  EMT21706 121 VGMKKTLVFHAGRAPKGERTNWVMHEYRLE 150
               ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6019170IPR003441NAC domain
PROSITE profilePS5100559.27922170IPR003441NAC domain
PfamPF023652.8E-2824149IPR003441NAC domain
PfamPF139665.3E-16733832IPR026960Reverse transcriptase zinc-binding domain
PfamPF134568.1E-179301031No hitNo description
CDDcd062225.22E-149331031No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1032 aa     Download sequence    Send to blast
MTHPSSSSSS APAAAPDDPT SLAPGFRFHP TDEELVSYYL KRKVLGRPLK VDAIAEVDLY  60
KVEPWDLPAR SRLRSRDSQW YFFSRLDRKH ANRARTNRAT AGGYWKTTGK DREVRHGARV  120
VGMKKTLVFH AGRAPKGERT NWVMHEYRLE GDGAAGIPQD SFVVCRIFQK AGPGPQNGAQ  180
YGAPFVEEEW EADEDDDFGP MPVQRDVFGE HEAPGAMEKG YLQMNDLIQD LAGQNENGSV  240
VLPVSDTSNT SSHSEDVEGN SGDILNDPSL GSNFLQYIHP GEQNSPMLNE NMLSNANVGD  300
FLNSSSPNDE FLELKDLELP LGNDSTIWPS DGWAWKTAFP LDAVNGANNE VPLITGDQPF  360
QPDELAQLLQ TLQDDSSQLG STMTDLPHSS ITNSVKPEDD SLMYFDAPFD NSMFSDGFRQ  420
TNGFLGSPAT ILSGIETLDD GIPYYDAMDD NLFNDMMCSV QQSAGSSSHV FNGPVLTQEV  480
NNPNYTYSPT QKVVEPNFVA GAPSSARLSE AGGQLNCVVL PDSQAKNGSM GKRFVKMLDS  540
ISAPPAFAAE FPGKSLSGVH PNTISVSTEV ISIGSLTVAS RQGKWSFQKD EDMELLFSTG  600
FQPDNRIHCG GCNTVTAVLR GGFCLFFLSA IMLLFIAKVD RVGRSNLSDE LMLFGASLAA  660
FSRMLSVARA IIASSQYFSV SLLDLMDPIT ETWDVELVKE LFCEEDAKEM PAIAVDSGMD  720
DLVAWHFDTK GLFSVKSAYH LGTRLRDASK DTDASSSTVV PQASQRWKRF WSLSLPPNIR  780
MFLWRLSHKS LLLRMNIKRK HVDLDTRCPM CLRLDEDGGH LFLKCKLVKQ VWRELQLEDV  840
RLVLLECVNP DAIFDHSGSL KPEKRDLMLV FLWEWWKVRN KANQGEKIKP AAGVAYYVRK  900
LLTDFYVEEG SIQAHTLPAI VQVCRKPKGS QEGRGAWGCV VGLGQGEFIA ACAGKLDYLV  960
SSLQAEATSC NKAIEAAGEM GLHQVIFESD SLQLVNAINS GDYNLSSIGV LSREARSLDA  1020
FEFNFCKRSC NC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-472117014168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0275740.0HM027574.2 Triticum aestivum NAC transcription factor NTL5 (NTL5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573214.10.0PREDICTED: NAC domain-containing protein 53-like
TrEMBLM8CEW00.0M8CEW0_AEGTA; NAC domain-containing protein 78
STRINGBRADI3G12470.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.17e-74NAC domain containing protein 53